The short version of reversed-phase fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-11-18 and is reviewed periodically as new material appears.
HPLC testing is not a single fixed procedure; it is a family of separation modes. Reversed-phase, normal-phase, ion-exchange, size-exclusion, and affinity chromatography each suit different analyte properties. Reversed-phase methods dominate because they handle many neutral and moderately polar compounds. Detection can be optical, electrochemical, or mass spectrometric, and the detector dictates what information is available. Coupling with mass spectrometry increases selectivity and enables identification when standards are unavailable. The technique cannot separate every mixture without adjustment.
HPLC testing is an analytical technique used to separate, identify, and quantify components in a liquid sample. It relies on a pressurized mobile phase that carries the sample through a column packed with stationary phase. Different compounds travel at different rates because of interactions with the stationary and mobile phases. The resulting signal versus time is a chromatogram. Peak position indicates identity under specified conditions, while peak area or height relates to amount.
Laboratories apply HPLC testing across pharmaceutical, food, environmental, and industrial chemistry. The method can measure active ingredients, impurities, additives, preservatives, and degradation products. Sample preparation often includes dilution, filtration, and sometimes extraction or derivatization. The choice of column, mobile phase, pH, temperature, and detector depends on the analytes and matrix. Results are compared with reference standards to assign identity and concentration. Method suitability is judged by resolution, precision, and accuracy.
Detection in HPLC testing commonly relies on ultraviolet-visible absorbance, fluorescence, refractive index, or mass spectrometry. UV detection is widely used because many organic compounds absorb light, but it requires a chromophore. Mass spectrometry provides mass-based identification and high sensitivity for trace analytes. Each detector has trade-offs in selectivity, cost, and compatibility with mobile phases. Quantification typically uses calibration curves prepared from reference standards. Results are reported as concentration, purity, or presence above a limit.
HPLC testing separates dissolved compounds by passing a liquid sample through a column packed with stationary phase. A pump delivers mobile phase at controlled flow, and the sample components interact differently with stationary and mobile phases. Compounds that spend more time in mobile phase elute earlier; those retained by stationary phase elute later. Detectors record elution as peaks, and peak area or height relates to amount. This mechanism underpins quantitative analysis of mixtures.
| Property | Value | Notes |
|---|---|---|
| Abbreviation | HPLC | Also called high-performance liquid chromatography |
| Separation mechanism | Differential partitioning | Compounds distribute between mobile and stationary phases |
| Typical column chemistry | C18 (octadecylsilane) | Used in reversed-phase separations |
| Typical detector | UV-Vis or photodiode array | Mass spectrometry is common for trace and confirmatory work |
| Typical particle size | 1.8–5 µm | Smaller particles require higher pressure and can improve speed |
Routine HPLC testing compares a sample result with a calibration curve prepared from known reference standards. Peak area or peak height is plotted against concentration, and the curve is used to estimate unknown amounts. Retention time supports tentative identification when compared with a standard, though mass spectrometry or another confirmatory method may be needed for definitive identification. Pre-run checks verify repeatability, resolution, and peak symmetry before sample analysis. Limits of detection and quantification describe the smallest amounts that can be reliably observed or measured. Sample preparation, filtration, and degassing help prevent column damage and inconsistent results.
High-performance liquid chromatography is an analytical technique that separates components in a liquid sample. A pump moves a liquid mobile phase through a column packed with a solid stationary phase. Compounds interact differently with both phases and travel at different rates, leaving the column at distinct retention times. A detector records these arrivals as peaks on a chromatogram. The resulting pattern supports identification and quantification of substances in mixtures. Modern instruments use high pressure to force solvent through small particles, which improves speed and resolution compared with older low-pressure liquid chromatography methods.
Separation in HPLC depends on the chemistry of the stationary phase, the composition of the mobile phase, and the physical properties of the column. Reverse-phase separations use a nonpolar stationary phase and a polar mobile phase, and they are common for many organic compounds. Ion-exchange, size-exclusion, and normal-phase modes serve other classes of analytes. Gradient elution changes solvent strength over time, while isocratic elution holds it constant. Flow rate, temperature, particle size, and column length all influence peak shape and resolution. Detection may use ultraviolet absorbance, fluorescence, refractive index, or mass spectrometry, depending on the analyte and the required sensitivity.
Detection in HPLC testing commonly relies on ultraviolet-visible absorbance, fluorescence, refractive index, or mass spectrometry. A diode array detector records full spectra across a wavelength range, which helps identify co-eluting peaks. Mass spectrometry provides mass-to-charge ratios and can confirm molecular identity at low concentrations. The choice of detector depends on analyte structure, required sensitivity, and whether quantitation or identification is the goal. No single detector works for every compound, and method development often compares responses before selecting one.
High-performance liquid chromatography is an analytical technique that separates components of a liquid sample by passing it through a packed column under pressure. A pump delivers a mobile phase at a controlled flow rate, and an injector introduces the sample into the stream. Differences in interaction with the stationary phase cause analytes to migrate at different rates. Detectors record elution as peaks, and a data system converts signals into a chromatogram. The method is suited to compounds that dissolve in a liquid and are not volatile enough for gas chromatography.
Reversed-phase chromatography dominates modern HPLC testing, using a nonpolar stationary phase such as chemically bonded octadecyl groups and a polar mobile phase of water mixed with organic solvent. Analytes partition between the mobile and stationary phases according to hydrophobicity. Gradient elution changes the mobile phase composition over time to separate compounds with a wide range of retention. Isocratic elution keeps the composition constant and is simpler for routine assays. Column temperature, pH, and flow rate influence selectivity, peak shape, and retention time, so these parameters are controlled during a validated method.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
In addition to killing bacteria directly they have been demonstrated to have a number of immunomodulatory functions that may be involved in the clearance of infection, including the ability to alter host gene expression, act as chemokines and/or induce chemokine production, inhibiting lipopolysaccharide induced pro-inflammatory cytokine production, promoting wound healing, and modulating the responses of dendritic cells and cells of the adaptive immune response. Animal models indicate that host defense peptides are crucial for both prevention and clearance of infection. It appears as though many peptides initially isolated as and termed "antimicrobial peptides" have been shown to have more significant alternative functions in vivo (e.g. hepcidin). Dusquetide for example is an immunomodulator that acts through p62, a protein involved in toll like receptor based signalling of infection. The peptide is being examined in a Phase III clinical trial by Soligenix (SGNX) to ascertain if it can assist in repair of radiation-induced damage to oral mucosa arising during cancer radiotherapy of the head and neck.
In organic chemistry, an amide, also known as an organic amide or a carboxamide, is a compound with the general formula R−C(=O)−NR′R″, where R, R', and R″ represent any group, typically organyl groups or hydrogen atoms. The amide functional group plays an important role in the chemistry of life where, as peptide bonds, they link amino acids together to form proteins. Amides can be viewed as a derivative of a carboxylic acid (R−C(=O)−OH) with the hydroxyl group (−OH) replaced by an amino group (−NR′R″); or, equivalently, an acyl (alkanoyl) group (R−C(=O)−) joined to an amino group. Common amides are formamide (H−C(=O)−NH2), acetamide (H3C−C(=O)−NH2), benzamide (C6H5−C(=O)−NH2), and dimethylformamide (H−C(=O)−N(−CH3)2). Amides are qualified as primary, secondary, and tertiary according to the number of acyl groups bounded to the nitrogen atom.
The American Society for Biochemistry and Molecular Biology publishes three research journals and a monthly magazine covering society news and activity updates. ASBMB journals are peer-reviewed and cover research in the fields of microbiology, molecular genetics, RNA-related research, proteomics, genomics, transcription, peptides, cell signaling, lipidomics, and systems biology. All articles are published online as "Papers in Press" upon acceptance. As of January 2021, all three ASBMB journals are fully open access.
5-Oxo-ETE and 5-oxo-15(S)-hydroxy-ETE but not 5-hydroxy members of the 5-HETE family such as 5-(S)-HETE activate peroxisome proliferator-activated receptor gamma (PPARγ). This activation does not proceed through OXER1; rather, it involves the direct binding of the oxo analog to PPARγ with 5-oxo-15-(S)-hydroxy-ETE being more potent than 5-oxo-ETE in binding and activating PPARγ. The Activation of OXER1 receptor and PPARγ by the oxo analogs can have opposing effects on cell function. For example, 5-oxo-ETE-bound OXER1 stimulates whereas 5-oxo-ETE-bound PPARγ inhibits the proliferation of various types of human cancer cell lines; this results in 5-oxo-ETE and 5-oxo-15-(S)-HETE having considerably less potency than anticipated in stimulating these cancer cells to proliferate relative to the potency of 5-(S)-HETE, a relationship not closely following the potencies of these three compounds in activating OXER1. 5-Oxo-ETE relaxes pre-contracted human bronchi by a mechanism that does not appear to involve OXER1 but is otherwise undefined.
Sources: en.wikipedia.org
The ABCA subfamily is composed of 12 full transporters split into two subgroups. The first subgroup consists of seven genes that map to six different chromosomes. These are ABCA1, ABCA2, ABCA3, and ABCA4, ABCA7, ABCA12, and ABCA13. The other subgroup consists of ABCA5 and ABCA6 and ABCA8, ABCA9 and ABCA10. A8-10. All of subgroup 2 is organized into a head to tail cluster of chromosomes on chromosome 17q24. Genes in this second subgroup are distinguished from ABCA1-like genes by having 37-38 exons as opposed to the 50 exons in ABCA1. The ABCA1 subgroup is implicated in the development of genetic diseases. In the recessive Tangier's disease, the ABCA1 protein is mutated. Also, the ABCA4 maps to a region of chromosome 1p21 that contains the gene for Stargardt's disease. This gene is found to be highly expressed in rod photoreceptors and is mutated in Stargardt's disease, recessive retinitis pigmentism, and the majority of recessive cone-rod dystrophy.
In enzymology, 4-aminobutyrate transaminase (EC 2.6.1.19), also called GABA transaminase or 4-aminobutyrate aminotransferase, or GABA-T, is an enzyme that catalyzes the reversible chemical reaction: GABA + α-ketoglutaric acid ⇌ {\displaystyle \rightleftharpoons } succinate semialdehyde + L-glutamic acid The two substrates of this enzyme are GABA and α-ketoglutaric acid. Its products are succinate semialdehyde and L-glutamic acid. Th enzyme is a transferase, specifically a transaminase, which transfer nitrogenous groups. The systematic name of this enzyme class is 4-aminobutanoate:2-oxoglutarate aminotransferase. This enzyme participates in 5 metabolic pathways: alanine and aspartate metabolism, glutamate metabolism, β-alanine metabolism, propanoate metabolism, and butanoate metabolism. It uses pyridoxal phosphate as a cofactor. This enzyme is found in prokaryotes, plants, fungi, and animals (including humans). Pigs have often been used when studying how this protein may work in humans.
Post-crash survivability is the chance that drivers and passengers survive a crash after it occurs. Technology such as Advanced Automatic Collision Notification can automatically place calls to emergency services and send information about a vehicle collision. Cars are much more dangerous to pedestrians than they are to drivers and passengers. Two-thirds of 1.3 million yearly auto related deaths are pedestrians. Since at least the early 1970s, attention has also been given to vehicle design regarding the safety of pedestrians in car-pedestrian collisions. Proposals in Europe would require cars sold there to have a minimum/maximum hood (bonnet) height. From 2006, the use of "bull bars", a fashion on 4x4s and SUVs, became illegal in the European Union, after having been banned on all new cars in 2002. Recent research has explored the use of multimodal sensor fusion to improve pedestrian detection in challenging conditions, including low-light environments and unusual pedestrian postures such as prone or fallen individuals.
In some reactions, protons and hydroxide may directly act as acid and base in term of specific acid and specific base catalysis. But more often groups in substrate and active site act as Brønsted–Lowry acid and base. This is called general acid and general base theory. The easiest way to distinguish between them is to check whether the reaction rate is determined by the concentrations of the general acid and base. If the answer is yes then the reaction is the general type. Since most enzymes have an optimum pH of 6 to 7, the amino acids in the side chain usually have a pKa of 4~10. Candidate include aspartate, glutamate, histidine, cysteine. These acids and bases can stabilise the nucleophile or electrophile formed during the catalysis by providing positive and negative charges.
The role of inflammation in cancer is not well understood. Some organs of the body show greater risk of cancer when they are chronically inflamed. While there is an association between increased levels of C-reactive protein and risk of developing cancer, there is no association between genetic polymorphisms influencing circulating levels of CRP and cancer risk. In a 2004 prospective cohort study on colon cancer risk associated with CRP levels, people with colon cancer had higher average CRP concentrations than people without colon cancer. It can be noted that the average CRP levels in both groups were well within the range of CRP levels usually found in healthy people. However, these findings may suggest that low inflammation level can be associated with a lower risk of colon cancer, concurring with previous studies that indicate anti-inflammatory drugs could lower colon cancer risk.
Sources: en.wikipedia.org
It measures the presence and amount of one or more compounds in a liquid sample. Separation occurs in a column, and detection produces a signal proportional to concentration. Identification usually requires comparison with a known reference standard under the same conditions.
In most cases the sample is consumed or altered during analysis, though some detectors are non-destructive. Fractions can be collected after separation for further study. Repeated testing therefore requires additional sample.
Run times range from under a minute for fast methods to over an hour for complex separations. Sample preparation, equilibration, and data review add time. Throughput depends on instrument configuration and method requirements.
It separates components in a liquid sample and measures their amounts using a detector. Results can indicate concentration, purity, or identity based on retention time and detector response. The technique works for mixtures that can be dissolved and filtered.